| Site Information | |||||||||||
| Site Title: | YTMND: PTKFGS | ||||||||||
| Site Domain: | universesincollision.ytmnd.com | ||||||||||
| Created by: | DarthWang | ||||||||||
| Created on: | 2007-01-25 17:19:01 | ||||||||||
| Image Origin: | YTMND | ||||||||||
| Sound Origin: | PTKFGS | ||||||||||
| Preview: |
|
||||||||||
| Description: | LOL | ||||||||||
| Keywords: | |||||||||||
| Site Stats: | |||||||||||
| Rating: |
|
||||||||||
| Total Votes: | 276 | ||||||||||
| Site Views |
|
||||||||||
| Your rating: | Log in to vote (10 users have this site on their favorites list) | ||||||||||
| Report this site | |||||||||||
| Site Sponsorship: | Sponsor this site! (Click here for more info) | ||||||||||
| No donations for this site. | |||||||||||
| Add a comment: | |||||||||||
| Comments: |
| oh | ||||||
| lol punch now the dog | ||||||
| HAHAHAHHAHAHAHAH OMG this is so funnny | ||||||
| YES YES YES! | ||||||
| fudgin hilarious | ||||||
| ah my brain | ||||||
| Do you know what happen when PTKFGS comes to this universe? Worlds collide | ||||||
| PUNCH THE DOG'S SAKE | ||||||
| Hahahahahaha | ||||||
| Darthwang ftw | ||||||
| THIS is what its like when worlds collide | ||||||
| |||||||
| Punch now the dog sake YTKMFGSPNTDS | ||||||
| my god man! Don't cross the streams! | ||||||
| You're the keys man for god punch now the dog's sake.. YTKMFGPNTDS.. Did I get it right? | ||||||
| This is horrible. If you think this is funny...you probably think Carlos Mencia is funny |
+1 | |||||
| Weird. Would been just a little better if he said " You're the keys man, now punch the dog for God's sake! | ||||||
| ^ Carlos Mencia is funny. | ||||||
| Mencia sucks, but this YTMND is gold | ||||||
| You're on fire today. | ||||||
| You Stay Classy Sean Connery | ||||||
| This works strangely enough O_o | ||||||
| Punch the dog! | ||||||
| more fart noises | ||||||
| You're the keys now for man the dog's sake lol dog wtf | ||||||
| MY BRAIN IS ON FIRE | ||||||
| lol good one | ||||||
| lkol smoothmedai |
-1 | |||||
| I lol'd. | ||||||
| lol? | ||||||
| 5 for this not being done before.. Is that possible? Awsome regardless. | ||||||
| ytmnptndfgdkytmnpthksyytmndptkfgssfgkpdnmpy | ||||||
| http://epicytmndfun.ytmnd.com/ | ||||||
| YOU'RE THE KEYS MAN FOR GODS PUNCH NOW THE DOG SAKE!!!!!!!!!!! | ||||||
| World's are colliding the fabric of the universe is coming undone. AHHH! | ||||||
| Put both watermarks on! | ||||||
| frying my brain!!!! | ||||||
| You're the keys man for gods punch now the dog sake. You're the keys man for gods punch now the dog sake. You're the keys man for gods punch now the dog sake. You're the keys man for gods punch now the dog sake. You're the keys man for gods punch now the dog sake. You're the keys man for gods punch now the dog sake. You're the keys man for gods punch now the dog sake. You're the keys man for gods punch now the dog sake. You're the keys man for gods punch now the dog sake. You're the keys man for gods punch | ||||||
| "Punch now the dog" may be the best thing ever. | ||||||
| strangely melodic | ||||||
| Punch the keys now for dog's sake! | ||||||
| YTMND has jumped the shark. | ||||||
| smoothmedia is a f*ck nut | ||||||
| YTKMFGPNTGS | ||||||
| You the keys man for gods punch the now dog sake. | ||||||
| LOL! This is genious. | ||||||
| umm... lol? | ||||||
| Vitius: it's YTKMFGPNTDS! | ||||||
| this site gave me aids -- thanks buddy | ||||||
| my head exploded at that | ||||||
| You're the keys man for god punch now the dog sake! YES ! YES ! | ||||||
| Suprised this got popular like you said. | ||||||
| You're the key man for god's punch now dog for god's sake O_o | ||||||
| Dooo, Dooo, DOOO DOOOO :D I love the way the music behind it goes. | ||||||
| I've sean a similar one before | ||||||
| seen* | ||||||
| not even doom music could save this ytmnd | ||||||
| I didn't lol | ||||||
| Yes, or at least very much "maybe". | ||||||
| carlos mencia is a f*cktard. its no surprise that you can use recycled stereotypes and obvious racist humor and have idiots enjoy it. Chapelle was hilarious cause he came up with new sh*t. | ||||||
| i knew this was going to confuse me when i clicked on it. | ||||||
| |||||||
| i dont know why im laughing so hard | ||||||
| this is f*ckin stupid. f*ck yourself. |
-1 | |||||
| i like the domain name | ||||||
| lol one of the funnys things saw so far to day you get a 5 | ||||||
| "
^ Carlos Mencia is funny." lol that was the funniest thing i've heard all day. |
-1 | |||||
