| Site Information | |||||||||||
| Site Title: | kelseypills pills pills pills idontlikefingersupmybuttwhydidyouleavemekelseykelseykelseypills | ||||||||||
| Site Domain: | idontlikefingersupmybutt.ytmnd.com | ||||||||||
| Created by: | iLOVEpillsNkelsey | ||||||||||
| Created on: | 2006-01-14 10:46:08 | ||||||||||
| Image Origin: | uncited | ||||||||||
| Sound Origin: | uncited | ||||||||||
| Preview: |
|
||||||||||
| Description: | |||||||||||
| Keywords: | |||||||||||
| Site Stats: | |||||||||||
| Rating: |
|
||||||||||
| Total Votes: | 607 | ||||||||||
| Site Views |
|
||||||||||
| Your rating: | Log in to vote (10 users have this site on their favorites list) | ||||||||||
| Report this site | |||||||||||
| Site Sponsorship: | Sponsor this site! (Click here for more info) | ||||||||||
| |||||||||||
| Add a comment: | |||||||||||
| Comments: |
1 | 2
| Kill yourself. | ||||||
| http://burgerbitch.ytmnd.com/ | ||||||
| FAIL | ||||||
| My favourite part is when I stuck a knife in my eye while watching it. | ||||||
| That's..... weird. | ||||||
| I'd hit it. | ||||||
| horrible | ||||||
| tehpwner2 would upvote this. Holy sh*t and someone sponsored it to? Just think about this...someone actually gave $50 of their money for this site. I cannot comprehend that. | ||||||
| You're a f*cking f*ggot dude. And this Kelsey girl is a fat ugly whore. You deserve to be sot through the head. | ||||||
| kill yourself | ||||||
| do it | ||||||
| lol its funny cuz youre a douchebag | ||||||
| You get my five-star rating because this is just absolutely absurd. | ||||||
| You suck emo | ||||||
| poor girl needs police protection... | ||||||
| Lol, Poor emo girl cant say nobody loves her anymore... but could say Only this crazy stalker loves me... | ||||||
| absolutely retarded | ||||||
| wow this sucks | ||||||
| this is definatly the worst ytmnd ever... | ||||||
| i smell emo on both ends of this crap dude. emo attention whore girls SUCK | ||||||
| What the hell? | ||||||
| I hope you get sodomized to death. This is the sh*ttiest site I've ever seen. | ||||||
| jesus christ, the more i watch this ytmnd the more it sucks total ass | ||||||
| I had to 1 this. | ||||||
| And holy sh*t that emo bitch is fugly. | ||||||
| That poor,poor Kelsey.... | ||||||
| Wow this is hilarious. Stop downvoting it. | ||||||
| F*G... | ||||||
| However many 1's you're going for, I admire your ambition. | ||||||
| rofl/. | ||||||
| That's just f*cking creepy. | ||||||
| not a good ytmnd, nope. | ||||||
| That girl is really ugly. and fat. | ||||||
| I changed my mind..........BEST YTMND EVAAAR!!!!!!!!!! | ||||||
| way to waste $50 on sh*t no one likes. | ||||||
| PILLS PILLS KELSEY KELSEY! | ||||||
| ? um how do you say? dumbass fuchead who made this get over her and find soneone new dicksucking c*nt face | ||||||
| Stop Spamming. Your site sucks. You fail at life. Good Day Sir! | ||||||
| 4 for all the retarded noobs who dont get it. | ||||||
| I honestly wonder why. /end sarcasm | ||||||
| I came | ||||||
| They killed this site? YTMND is officially over. | ||||||
| WHO THE F*CK KILLED THIS SITE? WHY?? | ||||||
| Unkill. This. Site. | ||||||
| You should commit myspace suicide. And for posting this crap on a great site THOR!!!
http://thor.ytmnd.com/ | ||||||
| You suck motherf*cking ass | ||||||
| Wow, a site devoted to an ugly emo chick. What will the kids think of next? | ||||||
| FYAD | ||||||
| dude, i don't get it! i know that that's extacy, and that's some emo girl you broke up with, but i'm not so sure how the two are connected. i mean the title is...odd, i don't really care to have fingers up my butt either, but...just, wtf? 2'd for loss of concept. | ||||||
| ok my computer's being gay so just PRETEND i gave you a two. | ||||||
| UNKILLED FOR ULTIMATE VICTORY | ||||||
| omg this site is still alive... oooooooooooooooooooooooooooh shi | ||||||
| |||||||
| wtf | ||||||
| dude guys I don't think you understand that this is a classic ytmnd. If the man wasn't serious, then F*CKING AWESOME GOOD JOB FOR PISSING OFF SO MANY 12 YEAR OLDS but if he is, then F*CKING AWESOME HOLY SH*T. I think we all need to reconsider our votes, like i have. I mean f*ck, this could have been deleted, but it wasn't. It wont ever be. Its just a classic part of ytmnd history | ||||||
| + 5'd 50 bucks holy sh*t, lmao | ||||||
| kelsey is a slut, so are you. personal sites are for myspace. | ||||||
| I am so sad for Kelsey | ||||||
| DUDE OMG SHE IS SITTING ON A BEAVER DAM I'M NOT SAD FOR HER ANYMORE | ||||||
| most underrated ytmnd ever |
+1 | |||||
| I agree. | ||||||
| Picture. Sound. Text. = 5 stars | ||||||
1 | 2
