Report a site: |
| Site Title: |
kelseypills pills pills pills idontlikefingersupmybuttwhydidyouleavemekelseykelseykelseypills |
| Site Domain: |
idontlikefingersupmybutt.ytmnd.com |
| Created by: |
iLOVEpillsNkelsey |
| Created on: |
2006-01-14 10:46:08 |
| Preview: |

|
| |
|
| Description: |
|
| Rating: |
|
Please note that this tool is for reporting sites which are against our terms of service. If your complaint has to do with a copyright issue please see our contact information. Misusing this tool may result in account suspension or deletion.
| Reason for reporting this site: | |
|